SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012790 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012790
Domain Number 1 Region: 146-716
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 9.3e-193
Family Myeloperoxidase-like 0.000000000115
Further Details:      
 
Domain Number 2 Region: 723-779
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000459
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 776-826
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000181
Family EGF-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012790   Gene: ENSPANG00000011149   Transcript: ENSPANT00000010098
Sequence length 915
Comment pep:known_by_projection chromosome:PapAnu2.0:13:1372876:1479741:1 gene:ENSPANG00000011149 transcript:ENSPANT00000010098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRARAVLAVTLIMACTEAFFPFISRGKELLWGKPEESRVASVLEESKRLVDTAMYTTMQR
NLKKREILSPHQLLSFSKLPEPTSGEIARAAEIMETSIQAMKRKVNLKIQQSQHPTDALS
EDLLSIIANVSGCLPYMLPPKCPNTCLANKYRFITGACNNRDHPRWGASNTALARWLPPV
YEDGFSQPRGWNPGFLHNGFPLPPVREVTRHVIQVSNEVVTDDDRYSDLLMAWGQYIDHD
IAFTPQSTSKAAFGGGADCQVTCENQNPCFPIQLPEEARPAAGTACLPFYRSSAACGTGD
QGALFGNLSTANPRQQMNGLTSFLDASTVYGSSPALERQLRNWTSAEGLLRVHARLRDSE
PGIPGETRGPCFLAGDGRASEVPSLTALHTLWLREHNRLAAALKALNAHWSADAVYQEAR
KVVGALHQIITLRDYVPRILGPEAFQQYVGPYEGYDSTANPTVSNVFSTAAFRFGHATIH
PLVRRLDTGFQEHPDLPGLWLHEAFFSPWTLLHGGGLDPLIRGLLARPAKLQVQDQLMNE
ELTERLFVLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGLPRLETPADLSTAIASRSV
ADKILDLYKHPDNIDVWLGGLAENFLPRARTGPLFACLIGKQMKALRDGDWFWWENSHVF
TDAQRHELEKHSLSRVICDNTGLTRVPVDAFRVGKFPEDFESCDSIPGMNLEAWRETFPQ
DDKCGFPESVENGDFVHCEESGRRVLVYSCRHGYELQGHEQLTCTQEGWDFQPPLCKDVN
ECADGAHPPCHASARCRNTKGGFQCLCADPYELGDDGRTCVDSGRLPRATWVSISLAALL
IGGLAGLTSTVICRWTRAGTKPTLPISETGGGTPRLRCGKHQGAGTSPQGAQAQPFLQES
AGMEGRDTHRLPRAL
Download sequence
Identical sequences ENSPANP00000012790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]