SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012800 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012800
Domain Number 1 Region: 31-377
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.87e-134
Family Calpain large subunit, catalytic domain (domain II) 0.00000000264
Further Details:      
 
Domain Number 2 Region: 384-430
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 4.97e-17
Family Calpain large subunit, middle domain (domain III) 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012800   Gene: ENSPANG00000023068   Transcript: ENSPANT00000021343
Sequence length 434
Comment pep:known_by_projection chromosome:PapAnu2.0:4:43547690:43558900:1 gene:ENSPANG00000023068 transcript:ENSPANT00000021343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPSLPESAESLDGSQEKPRSSYAEPTYTDTGMVAHINYSRLKASGVGQHHNAHNFGNQSF
EELRAACLRKGELFEDPLFPAEPSSLGFKDLGPNSKNVQNICWQRPKDIINNPLFIMDGI
SPTDVCQGILGDCWLLAAIGSLTTCPKLLYRVVPRGQSFKKNYAGIFHFQIWQFGQWVNV
VVDDRLPTKNDKLVFVHSTERSEFWSALLEKAYAKLSGSYEALSGGSTIEGFEDFTGGVA
QSFRLQRPPQNLLRLLRKAVERSSLMGCSIEVTSDSELESMTNKMLVRGHAYSVTGLQDV
HYRGKMETLIRVRNPWGRIEWNGAWSDRSSEWEEVAPDIQMQLLHKMEDGEFWMSYQDFL
NNFTLLEICNLTPDALSGDYKSYWHTTFYEGSWRRGSSAGGCRNHPGTFWTNPQFKISLP
EGDDPEDDTENDAV
Download sequence
Identical sequences ENSPANP00000012800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]