SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012809 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000012809
Domain Number - Region: 444-517
Classification Level Classification E-value
Superfamily TPR-like 0.0019
Family Tetratricopeptide repeat (TPR) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012809   Gene: ENSPANG00000005640   Transcript: ENSPANT00000009246
Sequence length 1240
Comment pep:known_by_projection chromosome:PapAnu2.0:3:2600540:2697059:-1 gene:ENSPANG00000005640 transcript:ENSPANT00000009246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENKPIVTCAGDQNLFTSVYPTLSQQLPREPMEWRRSYGRAPKMIHLESNFVQFKEELLP
KEGNKALLTFPFLHIYWTECCDTEVYKATVKDDLTKWQNVLKAHSSVDWLIVIVENDATN
ILPRTSIVDKIRNDFCNKQSDRCVVLSDPLKDSSRTQESWNAFLTKLRTLLLMSFTKNLG
KFEDDMRTLREKRTEPGWSFCEYFMVQEELAFVFEMLQQFEDALVQYDELDALFSQYVVN
FGAGDGANWLTFFCQPVKSWNGLILRKPIDMEKRESIQRREATLLDLRSYLFSRQCTLLL
FLQRPWEVAQRALELLHNCVQELKLLEVSVPPGALDCWVFLSCLEVLQRIEGCCDRAQID
SNIAHTVGLWSYATEKLKSLGYLCGLVSEKGPNSEDLNRTVDLLAGLGAERPETANTAQS
PYKKLKEALSSVEAFEKHYLDLSHATIEMYTSIGRIRSAKFVGKDLAEFYMRKKAPQKAE
IYLQGALKNYLAEGWALPITHTRKQLAECQKHLGQIENYLQTSSLLASDHHLTEEERKHF
CQEILDFASQPSDNPGHKIVLPMQSFAQLRDLHFDPSNAVVHVGGVLCIEITMYSQMPVP
VHVEQIVVNVHFSIEKNSYRKTAEWLTKHKTSNGIINFPPETAPFPVSQNSLPALELYEM
FERSPSDNSLNTTGIICRNVHMLLRRQESSSSLEMPSGVALEEGAHVLRCSHVTLEPGAN
QITFRTQAKEPGTYTLRQLCASVGSVWFVLPHIYPIVQYDVYSQEPQLHVEPLADSLLAG
IPQKVKFTVTTGHYTIKNGDSLQLSNAEAMLILCQAESRAMVYSNTREQSSDAALRIQSS
DKVTSISLPVAPAYHVIEFELEVLSLPSAPALGGESDMLGMAEPHRKHKDKQKTGHCMVT
TDHKVSIDCPWSIYSTVIALTFSVPFRTTHALLSSGTRKYVQVCVQNLSELDFQLSDSYL
VDTSDSTDLQLVPLNTQSQQPIYSKQSVFFVWELKWTEEPPPSLHCRFSVGFSPASEEQL
SISLKPYTYEFKVENFFTLYNVKAEIFPPSGMEYCRTGSLCSLEVLITRLSDLLEVDKDE
ALTESDEHFSTKLMYEVVDNSSNWAVCGKSCGVISMPVAARATHRVHMEVMPLFAGYLPL
PDVRLFKYLPHHSAHSSQLDADSWIENDSLSVDKHGDDQPDSSSLKSRGSVHSACSSEHK
GLPMPRLQALPAGQVFNSSSGTQVLVIPSQDDHVLEVSVT
Download sequence
Identical sequences ENSPANP00000012809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]