SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012859 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012859
Domain Number 1 Region: 100-247
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.14e-36
Family Glutathione S-transferase (GST), C-terminal domain 0.00000255
Further Details:      
 
Domain Number 2 Region: 19-97
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.54e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012859   Gene: ENSPANG00000024966   Transcript: ENSPANT00000021341
Sequence length 251
Comment pep:known_by_projection chromosome:PapAnu2.0:4:45231847:45340981:-1 gene:ENSPANG00000024966 transcript:ENSPANT00000021341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDSATANGDDRDPEIELFVKAGIDGESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKP
ADLHNLAPGTHPPFLTFNGDVKTDVNKIEEFLEETLTPEKYPKLAAKHRESNTAGIDIFS
KFSAYIKNTKQQNNAALERGLTKALKKLDDYLNTPLPEEIDANTCGEDKGSRRKFLDGDE
LTLADCNLLPKLHVVKIVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELA
YADVAKRLSRS
Download sequence
Identical sequences A0A096NIR1 A0A2J8Y519 A0A2K5JQV2 A0A2K5KV02 G3SBW3 H2QT41 Q53G01
ENSPTRP00000031153 gi|82617632|ref|NP_058625.2| ENSPANP00000012859 ENSPTRP00000031153 ENSP00000344165 NP_058625.2.87134 NP_058625.2.92137 XP_001142749.2.37143 XP_003833260.1.60992 XP_004044176.1.27298 XP_011815690.1.43180 XP_011926394.1.92194 ENSP00000344165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]