SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012910 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012910
Domain Number 1 Region: 274-522
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.22e-86
Family Eukaryotic proteases 0.00018
Further Details:      
 
Domain Number 2 Region: 179-280
Classification Level Classification E-value
Superfamily SRCR-like 2.35e-19
Family Hepsin, N-terminal domain 0.069
Further Details:      
 
Domain Number 3 Region: 144-182
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000012910
Domain Number - Region: 38-89
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.034
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012910   Gene: ENSPANG00000015992   Transcript: ENSPANT00000026609
Sequence length 525
Comment pep:known_by_projection chromosome:PapAnu2.0:3:5088598:5120430:1 gene:ENSPANG00000015992 transcript:ENSPANT00000026609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGLRILSLHKADIGHTEHSRYLSLLDAVDKSKMALNSGSPPGVGPYYENHGYQPENPYP
AQPTVASNVYEVHPAQYYPSPVPQYTPRVLTHASNPAVCTQPKSPSGTVCTSKTKKALCV
TMTLGAVLVGAALAAGLLWKFMGSKCSDSGIECDSSGTCISSSNWCDGVAHCPSGEDENR
CVRLYGPNFILQVYSSQRKSWHPVCRDDWNENYGRAACRDMGYKNSFYSSQGIADNSGAT
SFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVRSNLSRQSRIVGGQNALPGAW
PWQVSLHVQNIHVCGGSIITPEWIVTAAHCVEKPLNSPWQWTAFVGTLRQSSMFYEKGHR
VEKVISHPNYDSKTKNNDIALMKLHTPLTFNEVVKPVCLPNPGMMLEPEQHCWISGWGAT
QEKGKTSDVLNAAMVPLIEPRRCNSKYVYDGLITPAMICAGFLQGTVDSCQGDSGGPLVT
LKNDVWWLIGDTSWGSGCAKAYRPGVYGNVTVFTDWIYRQMRADD
Download sequence
Identical sequences ENSPANP00000012910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]