SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012914 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012914
Domain Number 1 Region: 157-219
Classification Level Classification E-value
Superfamily SEA domain 0.0000798
Family SEA domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000012914
Domain Number - Region: 91-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0586
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012914   Gene: ENSPANG00000022876   Transcript: ENSPANT00000014334
Sequence length 756
Comment pep:known_by_projection chromosome:PapAnu2.0:4:46292159:46328445:-1 gene:ENSPANG00000022876 transcript:ENSPANT00000014334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVGVLWLISFFTFTDGHGGFLGRNDGIKTKRELTVNKRKDLGPVQEYELLLQVTYRDSK
EKRDLRNFLKLLKPPLLWSHGLMIIRAKATTYCNNLNGVLQCTCEDGYTWFPPSCLDPQN
CYLHTAGALPSCECHLNNLSQSVNFCERTKIWGTFKINERFTNDLLNSSSAIYSKYATGI
EIQLKKAYKRIQGFESVQVTQFRNGSIVAGYEVVGSSSASELLSAIEQVAKKAKTALHML
FPLEDCSFRVFRKAQCNDIVFGFGSKDDEYTLPCSSGYRGSITARCQSSGWQAIRETCVL
PQLEELKKSFSMIAGNATEAAVSSLVQNLSVIIRQSPSTTAGNLASVVSILSNVSSLSLA
SHFRVSNSTMEDVINIADNILNSALVTNWTVLLQEEKHASSRLLQTLENISTLVPPTALP
LNFSRKFINWKGIPVTKSQPKTDYSYQIEILPQNSSIPIRGRVLIWKDQFQRSLPETIIS
MASLTLGNILPISKNGNAQVNGPVISTVIQNYSIDEVFLFFSKIESNLSQPHCVFWDFSH
LQWNNAGCHLVNETPDTVVCRCTHLTSFSMLMSPFVPATILPVVKWITYVGLGISIGSLI
LCLIIEALFWKQIKKSPTSHTRHICMVNIALSLLIADIWFIVGATVDAMVNSSGVCTAAV
FFTHVFYLSLFFWMLMLGILLAYRIILVFHHMARHFDGGCRIFAWVMGALSLYLSLPLLS
HNLAIPTQGKMCVGLTGPMEANHSWLLLSLHWLLWL
Download sequence
Identical sequences ENSPANP00000012914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]