SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012976 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012976
Domain Number 1 Region: 159-268
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.09e-34
Family PDI-like 0.0037
Further Details:      
 
Domain Number 2 Region: 21-129
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.63e-33
Family PDI-like 0.0021
Further Details:      
 
Domain Number 3 Region: 279-389
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000449
Family DsbC/DsbG C-terminal domain-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012976   Gene: ENSPANG00000006258   Transcript: ENSPANT00000024288
Sequence length 440
Comment pep:known_by_projection chromosome:PapAnu2.0:13:10062665:10094094:-1 gene:ENSPANG00000006258 transcript:ENSPANT00000024288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLGLGLVSCAFFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQR
LTPEWKKAATALKDVVKVGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTG
EAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDENVLDSEDV
WMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTI
KIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVA
VLPHILDTGAAGRNSYLEVLLKMADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMA
AINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTIIEREPWDGRDGELP
VEDDIDLSDVELDDLGKDEL
Download sequence
Identical sequences A0A096NJ27
ENSPANP00000012976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]