SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012989 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012989
Domain Number 1 Region: 61-309
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.3e-62
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.0011
Further Details:      
 
Domain Number 2 Region: 350-551,598-712
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.2e-39
Family Extended AAA-ATPase domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012989   Gene: ENSPANG00000017188   Transcript: ENSPANT00000004738
Sequence length 910
Comment pep:known_by_projection chromosome:PapAnu2.0:4:51370680:51395158:-1 gene:ENSPANG00000017188 transcript:ENSPANT00000004738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPGSPPLPRGNLWWREKFGSFRAGVESSREPSRYFGRGSSLAAGMAGTVVLDDVELREA
QRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEELVA
FQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVSPRTLTSCFLSCVVCVEGIVTKCS
LVRPKVVRSVHYCPATKKTIERRYSDLTTLVAFPSSSVYPTKDEENNPLETEYGLSVYKD
HQTITIQEMPEKAPAGQLPRSVDVILDDDLVDKAKPGDRVQVVGTYRCLPGKKGGYTSGT
FRTVLIACNVKQMSKDAQPSFSAEDIAKIKKFSKTRSKDIFDQLARSLAPSIHGHDYVKK
AILCLLLGGVERDLENGSHIRGDINILLIGDPSVAKSQLLRYVLCTAPRAIPTTGRGSSG
VGLTAAVTTDQETGDRRLEAGAMVLADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAK
AGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEQDR
EISDHVLRMHRYRAPGEQDGDAMPLGSAVDILATDDPNFSQEDQQDTQIYEKHDNLLHGT
KKKKEKMVSAAFMKKYIHVARIIKPVLTQESATYIAEEYSRLRSQDSMSSDTARTSPVTA
RTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQYAYFKKVLEKEKKRKKRSEDESETE
DEEEKSQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQ
KVELSESRLKAFKVALLDVFREAHAQSVGMNRLTESINRDSEEPFSSVEIQAALSKMQDD
NQMRDPSPIGSGLENPVSKDSAVVPEGGICHSLSIGNESEVVLGTAVGAKVVLSALRPLS
WGYVNMLVKI
Download sequence
Identical sequences ENSPANP00000012989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]