SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000012991 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000012991
Domain Number 1 Region: 554-639
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000121
Family Calmodulin-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000012991   Gene: ENSPANG00000020492   Transcript: ENSPANT00000028704
Sequence length 640
Comment pep:known_by_projection chromosome:PapAnu2.0:4:51541778:51619961:1 gene:ENSPANG00000020492 transcript:ENSPANT00000028704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSNPVHGLPFLPGTSFKDSTKTAFHRSQTLGYRNGYAIVRRPTVGIGGDRLQFNQLSQA
ELDELASKAPVLTYGQPKQAPPADFIPAHVAFDKKVLKFDAYFQEDVPMSTEEQYRIRQV
NIYYYLEDDSMSVIEPVVENSGIPQGKLIKRQRLAKNDRGDHYHWKDLNRGINITIYGKT
FRVVDCDQFTQVFLESQGIELNPPEKMALDPYTELRKQPLRKYVTPSDFDQLKQFLTFDK
QVLRFYAIWDDTDSMYGECRTYIIHYYLMDDTVEIREVHERNDGRDPFPLLMNRQRMPKV
LVENAKNFPQCVLEISDQEVLEWYTAKDFIVGKSLTVLGRTFFIYDCDPFTRRYYKEKFG
ITDLPRIDVNKQEPPPVKQELPPYNGFGLVEDSAQNCFALIPKAPKKDVIKMLVNDNKVL
RYLAALESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKPYSTVD
NPIYYGPSDFFIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSPEALASVQKHVRKLEA
PASESESKQTEKDPGVQELEALIDTIQKQLKDHSCKDNIREAFQIYDKEASGYVDRDMFF
KICESLNVPVDDSLVKELIRMCSHGEGKINYYNFVRAFSN
Download sequence
Identical sequences A0A096NJ42 A0A2K5MYE7 F6S496 G7P4V3
ENSPANP00000012991 NP_001252792.1.72884 XP_011755136.1.29376 XP_011925393.1.92194 9544.ENSMMUP00000018038 ENSMMUP00000018038 ENSMMUP00000018038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]