SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013026 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013026
Domain Number 1 Region: 258-405
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.56e-37
Family Glutathione S-transferase (GST), C-terminal domain 0.00000215
Further Details:      
 
Domain Number 2 Region: 182-256
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000253
Family Glutathione S-transferase (GST), N-terminal domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013026   Gene: ENSPANG00000019278   Transcript: ENSPANT00000009058
Sequence length 407
Comment pep:known_by_projection chromosome:PapAnu2.0:3:11831923:11876552:-1 gene:ENSPANG00000019278 transcript:ENSPANT00000009058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAEGPAGGTLRVSGEQQEGGDRSLPPQAEAIEVAAGESAGRSPGELAWDAAEETEVPGG
KGSEEVAPGDSRAEAVEDRVGDGPQQESGEEEERREQSPEGPSEEAAAGGEEEFPDSSPH
GEASRCAAEPEAQLSNHLAEEGPAEGGDEAARMNGRREDGEASEERALGQEHDITLFVKA
GYDGESIGNCPFSQRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNPPFMTFDGEVK
TDVNKIEEFLEEKLAPPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANEIYEKNLL
KALRKLDNYLNSPLPDEIDAYSTEDATVSGRKFLDGDELTLADCNLLPKLHIIKIVAKKY
RDFEFPSEMTGIWRYLNNAYARDEFTNTCPADQEIEHAYSDVAKRMK
Download sequence
Identical sequences ENSPANP00000013026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]