SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013032 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013032
Domain Number 1 Region: 81-195
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 7.67e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.00000198
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.47e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.0000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013032   Gene: ENSPANG00000017005   Transcript: ENSPANT00000020912
Sequence length 207
Comment pep:novel chromosome:PapAnu2.0:4:51891773:51942650:-1 gene:ENSPANG00000017005 transcript:ENSPANT00000020912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEIYLKSAEDLDKLRNDGSLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGIADLGEMILLLPICPPDRYFSA
FEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVK
KFLQPGSPRKPPMDAKSLEEARKIFRF
Download sequence
Identical sequences ENSPANP00000013032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]