SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013037 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013037
Domain Number 1 Region: 81-210
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.56e-34
Family Glutathione S-transferase (GST), C-terminal domain 0.000000753
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.02e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.0000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013037   Gene: ENSPANG00000019277   Transcript: ENSPANT00000020258
Sequence length 222
Comment pep:known_by_projection chromosome:PapAnu2.0:4:51964433:51971972:-1 gene:ENSPANG00000019277 transcript:ENSPANT00000020258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGKPKLHYFNGRGRMESIRWLLAAAGVEFEEKFIESAEDLEKLRNDGSLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAK
IALIKEKTKNRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISSFPL
LKALKTRISNLPAVKKFLQPGSPRKPPPDAKALEAARKIFRF
Download sequence
Identical sequences A0A096NJ85
ENSPANP00000013037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]