SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013080 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013080
Domain Number 1 Region: 138-212
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.28e-32
Family POU-specific domain 0.00024
Further Details:      
 
Domain Number 2 Region: 230-293
Classification Level Classification E-value
Superfamily Homeodomain-like 8.55e-17
Family Homeodomain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013080   Gene: ENSPANG00000007627   Transcript: ENSPANT00000026976
Sequence length 360
Comment pep:novel chromosome:PapAnu2.0:4:30606402:30612401:-1 gene:ENSPANG00000007627 transcript:ENSPANT00000026976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGI
PPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGAGVESNSDGASPEPCTVPTG
AVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFS
QTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENR
VRGSLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEA
AGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
Download sequence
Identical sequences A0A096NJD1 A0A2K5N686 A0A2K5UC29 B8XIA3
ENSPANP00000013080 XP_005553633.1.63531 ENSMMUP00000020598 9544.ENSMMUP00000020598 ENSMMUP00000020597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]