SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013095 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013095
Domain Number 1 Region: 613-855
Classification Level Classification E-value
Superfamily VPS9 domain 9.29e-50
Family VPS9 domain 0.00083
Further Details:      
 
Domain Number 2 Region: 47-146
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000194
Family SH2 domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013095   Gene: ENSPANG00000011339   Transcript: ENSPANT00000011691
Sequence length 976
Comment pep:known_by_projection chromosome:PapAnu2.0:7:148684633:148826992:1 gene:ENSPANG00000011339 transcript:ENSPANT00000011691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVPAVGKGEEEEEEDGVGLCLPATPKNCLPRRRGISILEKLIKTCPVWLQLSLGQAEVAR
ILHRVAAGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIKEEKSILYLEGSALVFED
IFRLIAFYCVSRDLLPFTLRLPQAILEASSFTDLETIANLGLGESSPRGQGSCRCPPRTR
ASPRWPSGSPSMPRAHQGQQCKRRHKAAMDWAWWLTPVKCPRQDWHGGLSVSEHSFSSAP
QLHLPTFSVAFATSSQWPVCRPWHFAAFTPPLPVLLLAPSSPGVEHPPVVQPASVATAMA
EPLGTGSTVLSPHTLCHQCPPSPDHPSQPPMTACERLPCPTAGLGPLREEAMKPGAASSP
LQQASPPPLPTKKNLPTAPPRRRVSERVSLEDQSPGMAAEGDQLSLPPQGTSDSPEDTPP
GSTEQGQDTEVKASDPDSVPELPRKAKQPPVPPPRKKRISRQLASTLPAPLENAELCTQA
MALETPTPGPPREGQSPASQAGTQHPQAQATAHSQSSAEFKGSLASLSDSLGASVMATDQ
DSYSTSSTEEELEQFSSPSVKKKPSMILGKARHRLSFASFSSMFHAFLSNNRKLYKKVVE
LAQDKASYFGSLVQDYKVYSLEMMARQTSSTEMLQEIRTMMTQLKSYLLQSTELKALVDP
ALHSEEELEAIVESALYKCVLKPLKEAINSCLHEIHSKDGSLQQLKENQLVILATTTTDL
GVTTSVPEVPMMEKILQKFAGMHKAYSPEKKISILLKTCKLIYDSMALGNPGKPYGADDF
LPVLMYVLARSNLTEMLLNVEYMMELMDPALQLGEGSYYLTTTYGALEHIKNYDKITVTR
QLSVEVQDSIHRWERRRTLNKARASRSSVQDFICVSYLEPEQQARTLASRADTPAQALCE
QCAEKFAVARPQAHRLFVLVDGRCFQLADDALPHRIKGYLLRSEPKRDFHFVYRPLDGGG
GGWSPPYLVVREPNFL
Download sequence
Identical sequences ENSPANP00000013095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]