SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013099 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013099
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-18
Family HkH motif-containing C2H2 finger 0.044
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000013099
Domain Number - Region: 55-79
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000471
Family CCCH zinc finger 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013099   Gene: ENSPANG00000020624   Transcript: ENSPANT00000025387
Sequence length 171
Comment pep:known_by_projection chromosome:PapAnu2.0:10:70275573:70312301:-1 gene:ENSPANG00000020624 transcript:ENSPANT00000025387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKF
LLTAGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAK
RLSSAPSSRAEPIRTTVFQYPVGWPPVQELPPSLRAPPPGGWPLQPRVQWG
Download sequence
Identical sequences ENSPANP00000013099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]