SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013114 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013114
Domain Number 1 Region: 121-195
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000192
Family PHD domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013114   Gene: ENSPANG00000020773   Transcript: ENSPANT00000021818
Sequence length 428
Comment pep:known_by_projection chromosome:PapAnu2.0:7:149336180:149363866:1 gene:ENSPANG00000020773 transcript:ENSPANT00000021818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAEGSAGRQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQGSVKRQALYA
CSTCTPEGEEPAGICLACSYECHGSHKLFELYTKRNFRCDCGNSKFKTLECKLLPDKAKV
NSGNKYNDNFFGLYCICKRPYPDPEDEIPDEMIQCVVCEDWFHGRHLGAIPPESGDFQEM
VCQACMKRCSFLWAYGAQLAEPTVTKISTEDDGLVRNIDGIGDQEVIKAENGEHQDSTLK
EDVPEQGKDDVQEVKAEQNSEPCASSSSESDLQTVFKNESLNAESKSGCRLQELKAKQFI
KKDTATYWPLNWRSKLCTCQDCMKMYGDLDVLFLTDEYDTVLAYENKGKIAQATDRSDPL
MDTLSSMNRVQQVELICEYNDLKTELKDYLKRFADEGTVVKREDIQQFFEEFQSKKRRRV
DGMQYYCS
Download sequence
Identical sequences ENSPANP00000013114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]