SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013184 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013184
Domain Number 1 Region: 368-611
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.23e-21
Family Nucleotide and nucleoside kinases 0.0079
Further Details:      
 
Domain Number 2 Region: 102-304
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0000000000000222
Family Tyrosine-dependent oxidoreductases 0.027
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000013184
Domain Number - Region: 682-717
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0222
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013184   Gene: ENSPANG00000015911   Transcript: ENSPANT00000027444
Sequence length 723
Comment pep:known_by_projection chromosome:PapAnu2.0:7:152559841:152659026:1 gene:ENSPANG00000015911 transcript:ENSPANT00000027444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEEETAAPTEKVIRIQRVFINLLDSYSSGNIGKFLSNCVVGASLEEITEEEEEEDENK
SATLEASSTKVKEGTFQIVGTLSKPASPRPDFAVETYSAISREDLLMRLLECDVIIYNIT
ESSQQVEEAIWAVSALNEEVSHFEKRKVFILLSTVMTWARSKALDPEDSEVPFTEEDYRR
RKSHPNFLDHINAEKMVLKFGRKTRKFATYVVAAGLQYGAEGGMLHTFFKMAWLGETPAL
PVFGDGTNVIPTIHVLDLAGVIQNVIDHTPKPHYLVAVDESVHTLEDIVKCISKNTGPGK
IQKIPRENAYLTKDLTQDCLDHLLVNLRMEALFVKENFNIRWVAQTGFVENINSILKEYK
QSRGLMPVKICILGPPAVGKSSIAEELAKYYKLHHIQLKDVISEAIAKLEMLFSLNFVGA
PSYENTEPYRAFLVEDAQELLDGIKESMEQNAGQLDDQYIIRFMKEKLKSMPCRNQGYIL
DGFPKTYDQAKDLFNQEDEEEEDEVRGRMFPFDKLIIPEFVCALDASDEFLKERVINLPE
RIVAGTHYSQDRFLRALSNYRDINIEDETVFNYFDEIEIHPIHIDVGKLEDAQNRLAIKQ
LIKEIGEPRNYGLTDEEKAEEERKAAEERLAREAAEEAEREHQEAVEMAEKIARWEEWNK
RLEEVKREERELLEAQSIPLRNYLMTYVMPTLIQGLNECCNVRPEDPVDFLAEYLFKNNP
EAQ
Download sequence
Identical sequences ENSPANP00000013184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]