SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013206 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013206
Domain Number 1 Region: 327-401
Classification Level Classification E-value
Superfamily F-box domain 2.35e-17
Family F-box domain 0.0034
Further Details:      
 
Domain Number 2 Region: 1-95
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000151
Family Ubiquitin-related 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013206   Gene: ENSPANG00000026268   Transcript: ENSPANT00000008159
Sequence length 522
Comment pep:known chromosome:PapAnu2.0:10:73036445:73059908:1 gene:ENSPANG00000026268 transcript:ENSPANT00000008159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLRVRLLKRTWPLEVPEAEPTLGQLRAHLSQALLCTWGYSSDTRFTITLNYKDALTGDE
ETLASYGIVSGDLICLILQDDIPAPNLPSSTDSEHSSLQNNDQPSLATSSNQTSLQDEQP
SDSFQGQAAQSDVWNDDSTLGPSQNFEAESIQDIEDMAEGTGFYPSEPMLCSESVEGQVP
HSLETLYQSADCSDANDALIVLIHLLMLESGYMPQGTEAKALSMPEKWKLSGVYKLQYMH
PLCEGSSAALTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGEHVAKIYKD
LQKLSRLFKDQLVYPLLAFTRQALSLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCR
DLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTH
GIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVADPINSLIPGPGETPSQFPPLRP
RFDPIGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM
Download sequence
Identical sequences A9CB44
ENSPANP00000013206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]