SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013225 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013225
Domain Number 1 Region: 40-274
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.34e-60
Family DNA replication initiator (cdc21/cdc54) N-terminal domain 0.00087
Further Details:      
 
Domain Number 2 Region: 341-650
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.5e-37
Family Extended AAA-ATPase domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013225   Gene: ENSPANG00000007031   Transcript: ENSPANT00000024324
Sequence length 734
Comment pep:known_by_projection chromosome:PapAnu2.0:10:75923042:75947283:1 gene:ENSPANG00000007031 transcript:ENSPANT00000024324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGFDDPGIFYSDSFGGDAAADEGQARKSQLQRRFKEFLRQYRVGTDRTGFTFKYRDELK
RHYNLGEYWIEVEMEDLASFDEDLADYLYKQPAEHLQLLEEAAKEVADEVTRPRPSGEEV
LQDIQVMLKSDASPSSIRSLKSDMMSHLVKIPGIIIAASAVRAKATRISIQCRSCRNTLT
NIAMRPGLEGYALPRKCNTDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGE
MPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLTSSRGRDRVGVGIRSSYIRVLGIQ
VDTDGSGRSFAGAVSPQEEEEFRRLAALPNVYEVISKSIAPSIFGGTDMKKAIACLLFGG
SRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVMR
DPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNS
RCSVLAAANSVFGRWDETKGEDNIDFMPTILSRFDMIFIVKDEHNEERDVMLAKHVITLH
VSALTQTQAVEGEIDLAKLKKFIAYCRAKCGPRLSAEAAEKLKNRYIIMRSGARQHERDS
DRRSSIPITVRQLEAIVRIAESLSKMKLQPFATEADVEEALRLFQVSTLDAALSGTLSGV
EGFTSQEDQEMLSRIEKQLKRRFAIGSQVSEHSIIKDFTKQKYPEHAIHKVLQLMLRRGE
IQHRMQRKVLYRLK
Download sequence
Identical sequences A0A096NJS2 A0A2K6AC51 G7N3Q0 G7PFA7
ENSPANP00000013225 XP_011834358.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]