SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013237 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013237
Domain Number 1 Region: 55-834
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.74e-279
Family Motor proteins 4.53e-16
Further Details:      
 
Domain Number 2 Region: 835-960
Classification Level Classification E-value
Superfamily Myosin rod fragments 5.41e-22
Family Myosin rod fragments 0.00034
Further Details:      
 
Domain Number 3 Region: 955-1071
Classification Level Classification E-value
Superfamily Myosin rod fragments 8.72e-21
Family Myosin rod fragments 0.001
Further Details:      
 
Domain Number 4 Region: 1241-1348
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.54e-17
Family Myosin rod fragments 0.0028
Further Details:      
 
Domain Number 5 Region: 1513-1626
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000137
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 6 Region: 1059-1149
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000235
Family Myosin rod fragments 0.0037
Further Details:      
 
Domain Number 7 Region: 1348-1449
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000314
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number 8 Region: 1758-1859
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00008
Family Regulator of G-protein signaling, RGS 0.0081
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000013237
Domain Number - Region: 27-60
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.0392
Family Myosin S1 fragment, N-terminal domain 0.0016
Further Details:      
 
Domain Number - Region: 1625-1742
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0602
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013237   Gene: ENSPANG00000012338   Transcript: ENSPANT00000023177
Sequence length 1959
Comment pep:known_by_projection chromosome:PapAnu2.0:10:76746459:76866768:-1 gene:ENSPANG00000012338 transcript:ENSPANT00000023177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAYVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
INFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNT
DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
TYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF
NHTMFILSRGVPARGHRVELHRLRLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDKS
FVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLLH
QSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMATL
RNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQRY
EILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKITD
VIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQVS
RQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAEE
LRARLTAKKQELEEICHDLEARVEEEEERCQHLQTEKKKMQQNIQELEEQLEEEESARQK
LQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSLAKL
KNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAKK
EEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEEL
EALKTELEDTLDTTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEEL
AEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVKF
NEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEEN
RQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVGCLE
TAEEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLEK
KQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNKQ
FRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEVN
LQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLKD
LEAHIDSANKNREEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEAE
MIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEEE
QGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGTV
KSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVDDERRNAEQY
KDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKL
RRGDLPFVMPRRMARKGAGDGSDEEVDGKADGAEAKPAE
Download sequence
Identical sequences ENSPANP00000013237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]