SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013257 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013257
Domain Number 1 Region: 558-809
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.75e-87
Family Eukaryotic proteases 0.0000923
Further Details:      
 
Domain Number 2 Region: 81-170
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000275
Family SEA domain 0.0063
Further Details:      
 
Domain Number 3 Region: 344-448
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000497
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 
Domain Number 4 Region: 493-524
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 5 Region: 529-568
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000314
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 242-327
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000017
Family Spermadhesin, CUB domain 0.0062
Further Details:      
 
Domain Number 7 Region: 458-491
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000262
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013257   Gene: ENSPANG00000018048   Transcript: ENSPANT00000005897
Sequence length 810
Comment pep:known_by_projection chromosome:PapAnu2.0:10:77279207:77340021:-1 gene:ENSPANG00000018048 transcript:ENSPANT00000005897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLFHSKRMPVAKAPQVAGGQGDGGDGEEAEPEGMFKAREDSKRKARGYLRLAPLWLTL
VVLTSVGVLLWYFLGYKAEVTVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQKML
KELIASTRLGTYYNSSSVYSFGEGPLTCFFWFILQIPEHRRPMLSPEVVQALLVEELLST
VNSSAAVPYRAEYEVDPKGLVILAEASVKDIAALNSTLGCYRYSYVGQGQVLRLKGPDHL
ASSCLWHLQGPKDLMLKLRLEWTLAECRDRLAMYDVAGPLEKRLITSVYGCSRQEPVVEV
LASGAIMAVVWKKGLHSYYDPFMLSVQPVVFQACEVNLTLDDRLDSQGVLSTPYFPSYYS
PRTHCSWHLTVPSLDYGLALWFDAYALRRQKYDLPCTQGQWTIQSRRLCGLRILQPYAER
IPVVATAGITINFTSQISLTGPGVRVHYGLYNQSDPCPGEFLCSVNGLCVPACDGVKDCP
NGLDERNCVCRATFQCQEDSTCISLLKVCDGQPDCLNGSDEERCQEGVPCGTFTFQCEDQ
SCVKKPNPQCDGRPDCRDGSDEQHCDCGLQGPSSRIVGGAVSSEGEWPWQASLQVRGRHI
CGGALIADRWVITAAHCFQEDSMASPALWTVFLGKVWQNSRWPGEVSFKVSRLLLHPYHE
EDSHDYDVALLQLDHPVVRSAAVRPVCLPARSHFFEPGLHCWITGWGALREGGPTSNALQ
KVDVQLIPQDLCSEAYRYQVTPRMLCAGYRKGKKDAARGDSGGPLVCKALSGRWFLAGLV
SWGLGCGRPNYFGVYTRITGVIGWIQQVVT
Download sequence
Identical sequences ENSPANP00000013257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]