SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013275 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013275
Domain Number 1 Region: 18-161,190-253
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.89e-49
Family BAR domain 0.0094
Further Details:      
 
Domain Number 2 Region: 273-469
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013275   Gene: ENSPANG00000015904   Transcript: ENSPANT00000005895
Sequence length 709
Comment pep:known_by_projection chromosome:PapAnu2.0:10:77885114:77901484:1 gene:ENSPANG00000015904 transcript:ENSPANT00000005895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKRQLHRMRQLAQTGSLGRTPETAEFLGEHLLQVEQRLEPAKRAAHNVHKRLQACLQGQ
SGADMDKRVKKLPLMALSTTMAESFKELDPDSSMGKALEMSCAIQNQLARILAEFEMTLE
RDVLQPLSRLSEEELPAILKHKKSLQKLVSDWNTLKSRLSQATKNSGSSQGLGGGPGSHS
HTTMANKVETLKEEEEELKRKVEQCRDEYLADLYHFVTKEDSYANYFIHLLEIQADYHRR
SLSSLDTALAELRENHGQADHSPSMAATHFSRVYGVSLATHLHELGREIALPIEACVMML
LSEGMKEEGLFRLAAGASVLKRLKQTMASDPHSLEEFCSDPHAVAGALKSYLRELPEPLM
TFDLYDDWMRAASLKEPGARLQALQEVCSRLPPENLSNLRYLMKFLARLAEEQEVNKMTP
SNIAIVLGPNLLWPPEKEGDQAQLDAASVSSIQVVGVVEALIQSADTLFPGDINFNVSGL
FSAVTLQDTVSDRLASEELPPSAVPTPTTTPAPAPAPVPAPALASAATKERTESEVPPRP
ASPKVTRSPPETAAPVEDMARRTKRPAPARPTMPPPQVSSSRSSPPAPPLPPGSGSPGTP
RALPRRLVGSSLRAPTVPPPLPPTPPQPARRQSRRSPASPSPASPGPASPSPASPGPASP
SPVSLSTPAQVDLGAATAEGGAPEAVGGVPTTPAIPPQPRPRSLASETN
Download sequence
Identical sequences A0A096NJX1
ENSPANP00000013275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]