SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013297 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013297
Domain Number 1 Region: 290-410,460-483
Classification Level Classification E-value
Superfamily TPR-like 4.7e-30
Family Tetratricopeptide repeat (TPR) 0.004
Further Details:      
 
Domain Number 2 Region: 213-328
Classification Level Classification E-value
Superfamily TPR-like 1.28e-23
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000013297
Domain Number - Region: 104-148
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 0.00314
Family N-terminal coiled coil domain from apc 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013297   Gene: ENSPANG00000012335   Transcript: ENSPANT00000016483
Sequence length 637
Comment pep:novel chromosome:PapAnu2.0:7:159854285:159898636:1 gene:ENSPANG00000012335 transcript:ENSPANT00000016483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYDNMSTMVYIKEDKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDD
ESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWL
RDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDTDSTKEPLDDLF
PNDEDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQAL
EDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATL
NNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEY
YYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVD
DENKPIWMHAEEREECKGKQKDGTSFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKF
EAAETLEEAAMRSRKQGLDNVHKQRVAEVLNDPENMEKRRSRESLNVDVVKYESGPDGGE
EVSMSVEWNGDGTGSLKRSGSFSKLRASIRRSSEKLVRKLKGGSSRESEPKNPGMKRASS
LNVLNVGGKAAEDRFQERNNCLADSRALSASHTDLAH
Download sequence
Identical sequences A0A1D5RJ26 A0A2I2Z5J7 A0A2I3LN97 A0A2K5DP18 A0A2K5JAW4 A0A2K5LRA5 A0A2K5PJ87 A0A2K5UQQ6 A0A2K6B8S3 A0A2K6M9M5 A0A2K6PZJ7
ENSPANP00000013297 XP_004055799.1.27298 XP_005562360.1.63531 XP_009247791.1.23681 XP_010351888.1.97406 XP_011753268.1.29376 XP_011939508.1.92194 XP_012326584.1.9421 XP_015000043.1.72884 XP_017717361.1.44346 ENSP00000246489 ENSP00000246489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]