SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013299 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013299
Domain Number 1 Region: 315-417
Classification Level Classification E-value
Superfamily TPR-like 0.00000939
Family Tetratricopeptide repeat (TPR) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013299   Gene: ENSPANG00000020963   Transcript: ENSPANT00000016487
Sequence length 608
Comment pep:known_by_projection chromosome:PapAnu2.0:10:78107577:78150099:1 gene:ENSPANG00000020963 transcript:ENSPANT00000016487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGLGKASGFPAGPRGGAELPASGRRRGPLISLFPAVLVSPVAMSYPADDYESEAAYDP
YAYPGDYDMHTGDPKQDLAYERQYEQQTYQVIPEVIKNFIQYFHKTVSDLIDQKVYELQA
SRVSSDVIDQKVYEIQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELY
YRHIYAKVSGGPSLEQRFESYYNYCNLFNYILNADGPAPLELPNQWLWDIIDEFIYQFQS
FSQYRCKTAKKSEEEIDFLRSNPKIWNVHSVLNVLHSLVDKSNINRQLEVYTSGGDPESV
AGEYGRHSLYKMLGYFSLVGLLRLHSLLGDYYQAIKVLENIELNKKSMYSRVPECQVTTY
YYVGFAYLMMRRYQDAIRVFANILLYIQRTKSMFQRTTYKYEMINKQNEQMHALLAIALT
MYPMRIDESIHLQLREKYGDKMLRMQKGDPQVYEELFSYSCPKFLSPVVPNYDNVHPNYH
KEPFLQQLKVFSDEVQQQAQLSTIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHK
MKNLVWTSGISALDGEFQSASEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFEELNRT
LKKMGQRP
Download sequence
Identical sequences A0A096NJZ5
ENSPANP00000013299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]