SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013311 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013311
Domain Number 1 Region: 143-354
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.79e-66
Family Arfaptin, Rac-binding fragment 0.0016
Further Details:      
 
Domain Number 2 Region: 52-101
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000158
Family PDZ domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013311   Gene: ENSPANG00000004812   Transcript: ENSPANT00000020080
Sequence length 408
Comment pep:known_by_projection chromosome:PapAnu2.0:10:78320447:78336713:1 gene:ENSPANG00000004812 transcript:ENSPANT00000020080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFADLDYDIEEDKLVGAPGFSFPRTSQSHKASLLNLTVPSLSSPTTLLMHPQVFDNTPAA
LDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLK
KVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYE
LSQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYL
NKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILR
CRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYAVLRDADVFP
IEVDLAHTTLAYGLNQEEFTDDTAAGEPSRDTRGAAGPLDKGGSWCDS
Download sequence
Identical sequences ENSPANP00000013311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]