SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013375 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013375
Domain Number 1 Region: 412-602,673-810,859-919
Classification Level Classification E-value
Superfamily ARM repeat 2.07e-40
Family Armadillo repeat 0.053
Further Details:      
 
Domain Number 2 Region: 21-134
Classification Level Classification E-value
Superfamily TPR-like 1.86e-27
Family Tetratricopeptide repeat (TPR) 0.0022
Further Details:      
 
Domain Number 3 Region: 155-508
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000173
Family Armadillo repeat 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013375   Gene: ENSPANG00000021759   Transcript: ENSPANT00000016523
Sequence length 947
Comment pep:known_by_projection scaffold:PapAnu2.0:JH687279.1:125446:143687:-1 gene:ENSPANG00000021759 transcript:ENSPANT00000016523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVSGPGTPEPRPATSGASSVEQLRKEGNELFKCGDYEGALGAYTQALGLDATPQDQAIL
HRNRAACHLKLEDYDKAETEASKAIEKDGGDVKALYRRSQALEKLGRLDQAVLDLQRCVS
LEPKNKVFQEALRNIGGQIQEKVRYMSSTDAKVEQMFQILLDPEEKGTEKKQKASQNLVV
LAREDAGAEKIFRSNGVQLLQRLLDTGETDLMLAALRTLVGICSEHQSRTVATLSILGTR
RVVSILGMENQAVSLAACHLLQVMFDALKEGVKKGFQGKEGAIIVDPARELKVLISNLLD
LLTEVGVSGQGRDNALTLLIKAVPRKSLKDPNNSLTLWVIDQGLKKILEVGGSLQDPPGE
LAVTANSRMSASILLSKLFDDLKCDAERENFHRLCENYIKSWFEGQGLAGKLRAIQTVSC
LLQGPCDAGNRALELSGVMESVIALCASEQEEEQLVAVEALIHAAGKAKRASFITANGVS
LLKDLYKRSEKDSIRIRALVGLCKLGSAGGTDFSMKQFAEGSTLKLAKQCRKWLCNDQID
AGTRRWAVEGLAYLTFDADVKEEFVEDAAALKALFQLSRSEERSVLFAVASALVNCTNSY
DYEEPDPKMVELAKYAKQHVPEQHPKDKPSFVRARVKKLLAAGVVSAMACMVKTESPVLT
SSCRELLSRVFLALVEEVEDRGTVVAQGGGRALIPLALEGTDVGQTKAAQALAKLTITSN
PEMTFPGERIYEVVRPLVSLLHLNCSGLQNFEALMALTNLAGISERLRQKILKEKAVPMI
EGYMFEEHEMIRRAATECMCNLAMSKEVQDLFEAQGNDRLKLLVLYSGEDDELLQRGGCR
GLCVPCQVEPVAWGSYLPCFSQTTHWLEILQALLLSSNQELQHRGAVVVLNMVEASRQIA
STLMESEMMEILSVLAKGDQSPVTRAAAACLDKAVEYGLIQPNQDGE
Download sequence
Identical sequences ENSPANP00000013375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]