SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013383 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013383
Domain Number 1 Region: 549-818
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-80
Family Protein kinases, catalytic subunit 0.00000102
Further Details:      
 
Domain Number 2 Region: 12-283
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.54e-55
Family FCH domain 0.01
Further Details:      
 
Domain Number 3 Region: 440-578
Classification Level Classification E-value
Superfamily SH2 domain 1.31e-27
Family SH2 domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013383   Gene: ENSPANG00000020549   Transcript: ENSPANT00000007571
Sequence length 822
Comment pep:known_by_projection scaffold:PapAnu2.0:JH687279.1:185879:196974:-1 gene:ENSPANG00000020549 transcript:ENSPANT00000007571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFSSELCTPQGHGVLQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSVQDSGGQS
RGISPDSPISQSWAEITSQTEGLSRLLRQHAEDLNSGPLSKLSLLIRERQQLRKTYSEQW
QQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLF
AHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDE
VVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTFDESLLEEGEPLEPGELQLNE
LTVESVQHTLTSVTDELAVATEMVFRRQEMVTQLQQELRNEEENTHPRGRVQLLGKRQAL
QEALQELQVARCSQAKLQAQQELLQTKLEQLGPGEPPPVLLLQDDRHSTSSSEQEREGGR
TPTLEILKSHISGIFRPKFSLPPPLQLVPEVQKPLHEQLWYHGAIPRAEVAELLVHSGDF
LVRESQGKQEYVLSVLWDGLPRHFIIQSLDNLYRLEGEGFPSIPLLIDHLLSTQQPLTKK
SGVVLHRAVPKDKWVLNHEDLVLGEQIGRGNFGEVFSGRLRADNTLVAVKSCRETLPPDI
KAKFLQEARILKQYSHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFLRTEGARLRVKTL
LQMVGDAAAGMEYLESKCCIHRDLAARNCLVTEKNVLKISDFGMSREEADGVYAASGGLR
QVPVKWTAPEALNYGRYSSESDVWSFGILLWETFSLGASPYPNLSNQQTREFVENRGRLP
CPELCPDAVFRLMEQCWAYEPGQRPSFSTIYQELQSIRKRHR
Download sequence
Identical sequences ENSPANP00000013383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]