SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013388 from Papio anubis 76

(show help)
Strong hits

Sequence:	ENSPANP00000013388
Domain Number 1	Region: 157-204
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	5.64e-16
Family	LIM domain	0.0011
Further Details:

Domain Number 2	Region: 31-79
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000000000114
Family	LIM domain	0.00078
Further Details:

Domain Number 3	Region: 116-156
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.000000000000613
Family	LIM domain	0.0069
Further Details:

Domain Number 4	Region: 3-30
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.000000000202
Family	LIM domain	0.0036
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

External link(s)	Protein: ENSPANP00000013388 Gene: ENSPANG00000022246 Transcript: ENSPANT00000004740
Sequence length	213
Comment	pep:known_by_projection chromosome:PapAnu2.0:7:161701135:161706475:1 gene:ENSPANG00000022246 transcript:ENSPANT00000004740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYAT LFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPTARPEERKASGPPKGPSRARAPTASS VTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCH KPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP
Download sequence
Identical sequences	ENSPANP00000013388

SEARCH