SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013391 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013391
Domain Number 1 Region: 345-382
Classification Level Classification E-value
Superfamily SAP domain 0.000000000366
Family SAP domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013391   Gene: ENSPANG00000024733   Transcript: ENSPANT00000024903
Sequence length 935
Comment pep:known_by_projection chromosome:PapAnu2.0:10:80670384:80843825:-1 gene:ENSPANG00000024733 transcript:ENSPANT00000024903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPLKSPAAFHEQRRSLERARTEDYLKRKIRSRPERSELVRMHILEETSAEPSLQAKQLK
LKRARLADDLNEKIAQRPGPMELVEKNILPVESSLKEAIIVGQVNYPKVADSSSFDEDSS
DALSPEQPASHESQGSVPSPLEARVSEPLPSATSASPTQVVSQLPMGPDSGEMLFLAEQP
PLPPPPLLPPSLTNGTTVPTAKPTPTLIKQSQPKSASEKSQRSKKAKELKPKVKKLKYHQ
YIPPDQKQDRGAPPMDSSYAKILQQQQLFLQLQILNQQQQQHHNYQAILPAPPKSAGEAL
GSSGTPPVRSLSTTNSSSSSGAPGPCGLARQNSTSLTGKPGALPANLDDMKVAELKQELK
LRSLPVSGTKTELIERLRAYQDQIGPVPGAPKAPATTSILHKAGEVVVAFPAARLSTGPA
LVAAGLAPTEVVVATVTSNGVVKFGSTGSTPPVSPTPSERSLLSTGDENSTPGDTFGEMV
TSPLTQLTLQASPLQILVKEEGPRAGSCCLSPGGRAELEGRDKDQMLQEKDKQIEELTRM
LRQKQQLVERLRLQLEQEKRAQQPAPTPVPTPAPLGMPVKQENSFSSCQLSRQPLGPAHP
FSPSLAAPTTNHVDPCAAAPGPPSVVVKQEAVQPEPEPVPAPQLLLGPQGPGLIKGVAPP
TLITDSTGTHLVLTVTNKNADSPGLSSGSPQQPSSQPGSPVPAASAQMDLEHPLQPVFGT
PTSLLKKEPPGYEEAMSQQPKQQENGSSSQQMDDLFDILIQSGEISADFKEPPSLPGKEK
PSPKTACGSPLAAQPSPSAELPQAAPPPPGSPSLPGRLEDFLESSTGLPLLTSGHEGPEP
LSLIDDLHSQMLSSTAILDHPPSPMDTSELHFAPEPSSTMGLDLADGHLDSMDWLELSSG
GPVLSLAPLSTTAPSLFSTDFLDGHDLQLHWDSCL
Download sequence
Identical sequences A0A096NK86 A0A2K5WTK4 A0A2K6BRQ1
ENSPANP00000013391 XP_005567242.1.63531 XP_005567243.1.63531 XP_011710565.1.29376 XP_011710566.1.29376 XP_011710567.1.29376 XP_011710568.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]