SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013401 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013401
Domain Number 1 Region: 113-215
Classification Level Classification E-value
Superfamily TPR-like 3.8e-24
Family Tetratricopeptide repeat (TPR) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013401   Gene: ENSPANG00000015759   Transcript: ENSPANT00000024767
Sequence length 369
Comment pep:known_by_projection chromosome:PapAnu2.0:10:81066551:81098973:-1 gene:ENSPANG00000015759 transcript:ENSPANT00000024767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPRKVNELRAFVKMCKQDPSVLHTEEMRFLREWVESMGGKVPPATQKAKSEENTKEEKP
DSKKVEEDLKADEPSSEESDLEIDKEGVIEPDTDSPQEMGDENVEITEEMMDQANDKKVA
AIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPD
SAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLKEVQPRAQKIAEHRRKYER
KREEREIKERIERVKKAREEHERAQREEEARRQSGAQYGSFPGGFPGGMPGSFPGGMPGM
GGAMPGMAGMPGLNEILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQSNPKVMNLISK
LSAKFGGQA
Download sequence
Identical sequences A0A096NK96
ENSPANP00000013401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]