SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013410 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013410
Domain Number 1 Region: 36-153
Classification Level Classification E-value
Superfamily TPR-like 1.09e-19
Family Tetratricopeptide repeat (TPR) 0.0081
Further Details:      
 
Domain Number 2 Region: 832-870
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000179
Family Classic zinc finger, C2H2 0.054
Further Details:      
 
Domain Number 3 Region: 884-918
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000275
Family CCCH zinc finger 0.0048
Further Details:      
 
Domain Number 4 Region: 482-511
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000804
Family CCCH zinc finger 0.005
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000013410
Domain Number - Region: 755-787
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000157
Family CCCH zinc finger 0.0069
Further Details:      
 
Domain Number - Region: 611-642
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00255
Family CCCH zinc finger 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013410   Gene: ENSPANG00000019690   Transcript: ENSPANT00000009867
Sequence length 978
Comment pep:known_by_projection chromosome:PapAnu2.0:10:81586270:81626881:1 gene:ENSPANG00000019690 transcript:ENSPANT00000009867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERQKRKADIEKGLQFIQSTLPLKQEEYEAFLLKLVQNLFAEGNDLFREKDYKQALVQYM
EGLNVADYAASDQVALPRELLCKLHVNRAACYFTMGLYEKALEDSEKALGLDSESIRALF
RKARALNELGRHKEAYECSSRCSLALPHDESVTQLGQELAQKLGLRVRKAYKRPQELETF
SLLSNGTAAGVADQGTSNGLGSIDDIETDCYVDPRASPALLPSTPTMPLFPHVLDLLAPL
DSSRTLPSTDSLDDFSDGDVFGPELDTLLDSLSLVQGGLSGSGVPSELPQLIPVFPGGTP
LLPPVVGGSIPVSSPLPPASFGLVMDPSKKLAASVLDALDPPGPTLDPLDLLPYSETRLD
ALDSFGSTRGSLDKPDSFMEETNSQDHRPPSGAQKPAPSPEPCMPNTALLIKNPLAATHE
FKQACQLCYPKTGPRAGDYTYREGLEHKCKRDILLGRLRSSEDQTWKRIRPRPTKTSFVG
SYYLCKDMINKQDCKYGDNCTFAYHQEEIDVWTEERKGTLNRDLLFDPLGGVKRGSLTIA
KLLKEHQGIFTFLCEICFDSKPRIISKGTKDSPSVCSNLAAKHSFYNNKCLVHIVRSTSL
KYSKIRQFQEHFQFDVCRHEVRYGCLREDSCHFAHSFIELKVWLLQQYSGMTHEDIVQES
KKYWQQMEAHAGKASSSMGAPRTHGPSTFDLQMKFVCGQCWRNGQVVEPDKDLKYCSAKA
RHCWTKERRVLLVMSKAKRKWVSVRPLPSIRNFPQQYDLCIHAQNGRKCQYVGNCSFAHS
PEERDMWTFMKENKILDMQQTYDMWLKKHNPGKPGEGTPISSREGEKQIQMPTDYADIMM
GYHCWLCGKNSNSKKQWQQHIQSEKHKEKVFTSDSDASGWAFRFPMGEFRLCDRLQKGKA
CPDGDKCRCAHGQEELNEWLDRREVLKQKLAKARKDMLLCPRDDDFGKYNFLLQEDGDPA
GATPEAPAAAAAATTTGE
Download sequence
Identical sequences A0A096NKA5
ENSPANP00000013410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]