SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013415 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013415
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 3.79e-23
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.0014
Further Details:      
 
Domain Number 2 Region: 79-197
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000001
Family Cold shock DNA-binding domain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013415   Gene: ENSPANG00000015758   Transcript: ENSPANT00000019928
Sequence length 204
Comment pep:known_by_projection chromosome:PapAnu2.0:10:81800006:81815628:-1 gene:ENSPANG00000015758 transcript:ENSPANT00000019928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLCICLFDITKLEDAYVF
PGDGASHTKVHFRYVVFHPFLDEILIGKIKGCSPEGVHVSLGFFDDILIPPESLQQPAKF
DEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKK
EAPYTLVGSISEPGLGLLSWWTSN
Download sequence
Identical sequences A0A096NKB0 A0A2J8TWQ4 A0A2K5KYD1 A0A2K6B0G8 F7BKF0 G7PFN5
NP_001253541.1.72884 NP_001272187.1.63531 XP_007974101.1.81039 XP_011710514.1.29376 XP_011886407.1.92194 XP_011886433.1.92194 XP_015005886.1.72884 XP_015312427.1.63531 XP_015312428.1.63531 ENSPANP00000013415 9544.ENSMMUP00000036969 ENSMMUP00000001947 ENSMMUP00000001945 ENSMMUP00000036969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]