SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013416 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013416
Domain Number 1 Region: 57-135
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000235
Family Cold shock DNA-binding domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013416   Gene: ENSPANG00000014567   Transcript: ENSPANT00000019771
Sequence length 153
Comment pep:known_by_projection chromosome:PapAnu2.0:10:81844268:81847144:1 gene:ENSPANG00000014567 transcript:ENSPANT00000019771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSAT
ARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPI
PPKNQKFQAVEVVLTQLAPHTPHETWSGQVVGS
Download sequence
Identical sequences A0A096NKB1 A0A0D9R0G4 A0A2I2ZCA5 A0A2K5MEH8 A0A2K5YZ27 A0A2K6RD87 H2P4J8 K7D015 Q9Y534
ENSPANP00000013416 9600.ENSPPYP00000013250 9606.ENSP00000302485 ENSP00000302485 ENSPPYP00000013250 gi|24307959|ref|NP_055275.1| ENSP00000302485 NP_055275.1.87134 NP_055275.1.92137 XP_002831237.1.23681 XP_003814681.1.60992 XP_007974109.1.81039 XP_010374025.1.97406 XP_011834159.1.47321 XP_011886356.1.92194 XP_016794759.1.37143 XP_018873664.1.27298 ENSP00000302485 ENSPPYP00000013250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]