SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013421 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013421
Domain Number 1 Region: 255-534
Classification Level Classification E-value
Superfamily SPOC domain-like 1.16e-86
Family Ku70 subunit middle domain 0.000000000153
Further Details:      
 
Domain Number 2 Region: 34-254
Classification Level Classification E-value
Superfamily vWA-like 2.27e-59
Family Ku70 subunit N-terminal domain 0.00000000263
Further Details:      
 
Domain Number 3 Region: 561-609
Classification Level Classification E-value
Superfamily SAP domain 0.00000000000061
Family SAP domain 0.0000763
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013421   Gene: ENSPANG00000001252   Transcript: ENSPANT00000005890
Sequence length 610
Comment pep:known_by_projection chromosome:PapAnu2.0:10:81892315:81931324:1 gene:ENSPANG00000001252 transcript:ENSPANT00000005890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDELTPF
DMSIQQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKRILEL
DQFKGQQGQKRFQDLMGHGSDYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNPHGND
SAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDDDLRVHFEESSKL
EDLLRKVRAKETRKRALSRLKLKLNKDIVISVGVYNLVQKALKPPPIKLYRETNEPVKTK
TRTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVLLKKH
HYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRYTPRRNIPPYFVALVPQDEE
LDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVDKMKAIVEKLRFTYRSDSFE
NPVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYNPEGK
VTKRKHDNDGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLKKQEL
LEALTKHFQD
Download sequence
Identical sequences ENSPANP00000013421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]