SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013434 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013434
Domain Number 1 Region: 294-421
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.53e-43
Family Regulator of G-protein signaling, RGS 0.00000277
Further Details:      
 
Domain Number 2 Region: 15-118
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.95e-29
Family DEP domain 0.0054
Further Details:      
 
Domain Number 3 Region: 217-280
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 1.96e-17
Family Transducin (heterotrimeric G protein), gamma chain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013434   Gene: ENSPANG00000000729   Transcript: ENSPANT00000005889
Sequence length 469
Comment pep:novel chromosome:PapAnu2.0:20:148710:157283:-1 gene:ENSPANG00000000729 transcript:ENSPANT00000005889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LALAPAPQPVGHPRRPRPADLRKMERVVVSMQDPDQGVKMRSQRLLVTVIPHAVTGSDVV
QWLTQKFCVSEEEARHLGAVLVQHGYIYPLRDPRSLVLRPDETPYRFQTPYFWTSTLWPA
AELDYAIYLAKKNIRKQGTLVDYEKEYYDRLHTKINHAWDLVLMQAREQLRAAKQRRKGD
RLVIACQEQTYWLVNRPPPGAPSVLEQSPGRGSCAASHVHMTKRADFYKQEIEYCRRALG
RTRVKSSVCLEAYLSFCSQRGPHDPLVSGCLPSNPWISDNDAYWVMNAPTVVAPTKLRVE
RWGFSFRELLEDPVGRAHFMDFLGKEFSGENLSFWEACEELRYGAQAQVPTLVDAVYQQF
LAPGAARWVNIDSRTMERTLEGLRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKGLL
AEAGIPLETKKRVFPFSRRPRHSGPSPALLPAPVEPTAAGGPGGGDGVA
Download sequence
Identical sequences ENSPANP00000013434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]