SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013435 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013435
Domain Number 1 Region: 282-409
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.4e-43
Family Regulator of G-protein signaling, RGS 0.00000277
Further Details:      
 
Domain Number 2 Region: 13-116
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.99e-30
Family DEP domain 0.0054
Further Details:      
 
Domain Number 3 Region: 218-268
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.0000000000000379
Family Transducin (heterotrimeric G protein), gamma chain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013435   Gene: ENSPANG00000000729   Transcript: ENSPANT00000007286
Sequence length 457
Comment pep:known chromosome:PapAnu2.0:20:148710:156731:-1 gene:ENSPANG00000000729 transcript:ENSPANT00000007286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGPAPPPGRPRAQMPHLRKMERVVVSMQDPDQGVKMRSQRLLVTVIPHAVTGSDVVQW
LTQKFCVSEEEARHLGAVLVQHGYIYPLRDPRSLVLRPDETPYRFQTPYFWTSTLWPAAE
LDYAIYLAKKNIRKQGTLVDYEKEYYDRLHTKINHAWDLVLMQAREQLRAAKQRRKGDRL
VIACQEQTYWLVNRPPPGAPSVLEQSPGRGSCAASHVHMIEYCRRALGRTRVKSSVCLEA
YLSFCSQRGPHDPLVSGCLPSNPWISDNDAYWVMNAPTVVAPTKLRVERWGFSFRELLED
PVGRAHFMDFLGKEFSGENLSFWEACEELRYGAQAQVPTLVDAVYQQFLAPGAARWVNID
SRTMERTLEGLRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKGLLAEAGIPLETKKR
VFPFSRRPRHSGPSPALLPAPVEPTAAGGPGGGDGVA
Download sequence
Identical sequences A9L8U3
ENSPANP00000013435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]