SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013441 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013441
Domain Number 1 Region: 6-111
Classification Level Classification E-value
Superfamily PH domain-like 8.2e-20
Family GRAM domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013441   Gene: ENSPANG00000008690   Transcript: ENSPANT00000006825
Sequence length 183
Comment pep:known_by_projection chromosome:PapAnu2.0:10:82278156:82308159:1 gene:ENSPANG00000008690 transcript:ENSPANT00000006825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTILLKQSPNVELSFPRQSEGSNVFSGTKTGTLFLTSYRVIFITSRSINDPMLSFMMPFD
LITNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNGGAIEFAQLMVKAASSAAR
GFPLRTLNDWFSSMRIYVITGEGNICTPQMPCSVIAYGAPPAGYGAPPPGYGAPAGYGAP
PPG
Download sequence
Identical sequences ENSPANP00000013441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]