SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013444 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013444
Domain Number 1 Region: 386-505
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.35e-29
Family PDI-like 0.0021
Further Details:      
 
Domain Number 2 Region: 258-396
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.65e-19
Family Thioltransferase 0.064
Further Details:      
 
Domain Number 3 Region: 166-271
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000132
Family PDI-like 0.001
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000013444
Domain Number - Region: 41-158
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000154
Family PDI-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013444   Gene: ENSPANG00000000823   Transcript: ENSPANT00000006829
Sequence length 535
Comment pep:novel chromosome:PapAnu2.0:20:165896:169255:1 gene:ENSPANG00000000823 transcript:ENSPANT00000006829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQLLPVLLLLLRASCPWGQEQGPKSPSEEPPEEEIPKEDGILVLSRHTLGLALREHPA
LLVEFCECWGTCPHCAQELSRRVLGVRLGQAGAVVVLGVPTGHIGTVLAWEVFTGSHMGL
GAPALQGRKNGNRTHPEEYTGPREAEGIAEWLRRRVGPSAKQLEDEAAAQALIDGRDLVV
IGFFQDLQDEDVATFLALARDALDMTFGLTDRPRLFEQFGLTKDTVVLFKKFDEGRADFP
VDEELGLDLGDLSRFLVTHSMHLVTEFNSQTSPKIFAARILNHLLLFLNQTLAAHRELLA
GFGEAAPHFRPQVLFVVVDVAADNEHVLQYFGLKAEAAPTLRFINVETTKKYAPVDGGPV
TAASVTAASVTAFCHAVLNGQVKPYLLSQEVPPDWDQRPVKTLVGKNFEQVAFDETKNVF
VKFYAPWCTHCKEMAPAWEALAEKYQDHEDIIIAQLDATANELDAFTVHSFPTLKYFPAG
PGRKVIEYKSTRDLETLSKFLDNGGAVPTEEPTEEPAAPFPEPRANSTVGSKEEL
Download sequence
Identical sequences ENSPANP00000013444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]