SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013448 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013448
Domain Number 1 Region: 76-218
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.24e-41
Family Regulator of G-protein signaling, RGS 0.000000063
Further Details:      
 
Domain Number 2 Region: 772-853
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.96e-27
Family DIX domain 0.00000922
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013448   Gene: ENSPANG00000010773   Transcript: ENSPANT00000025665
Sequence length 853
Comment pep:novel chromosome:PapAnu2.0:20:170246:235691:-1 gene:ENSPANG00000010773 transcript:ENSPANT00000025665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPASYSFCSGKGVGIKAETSTAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFA
CTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPA
MFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGISGYLPT
LNEDEEWKCDQDMDEDDGRDAAPPGRLPQKLLLETAAPRASSSRRYSEGREFRYGSWREP
VNPYYVNAGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESV
QVNGRVPLPHIPRTYRVPKEVRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEE
EGEDGDPSSGLPGPCHKLPPAPAWHHFPPRCVDVGCAGLRDAHEENPESILDEHVQRVLR
TPGRQSPGPGHRSPDSGHMAKMPVALGSAASGHGKHAPKSGVKLDAAGLTARPKEQVEAE
AARRAQSSFAWGPEPHSHGAKSRGYSESVGAAPNASDGLAHSGKAGMACKNAKKAESGKS
ASAEVPGASEDAEKNQKIMQWIIEGEKEISRHRRTGHGSSGTRKPQPHENSRPLSLERPG
AVHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLEEEEKRASRAPSKQR
YVQEVMRRGRACVRPACAPVLRVVPAVSDMELSETETRSQRKAGGGSAQPCDSIVVAYYF
CGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPV
FEEKIIGKVEKVD
Download sequence
Identical sequences ENSPANP00000013448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]