SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013453 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000013453
Domain Number - Region: 497-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0293
Family EGF-type module 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013453   Gene: ENSPANG00000026168   Transcript: ENSPANT00000006851
Sequence length 771
Comment pep:known_by_projection chromosome:PapAnu2.0:20:252700:263612:-1 gene:ENSPANG00000026168 transcript:ENSPANT00000006851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAGTGTGGEAVAAVVAGPLLLLLLARPPPASARDSGKSEVGLVSEHFSQAPQRLSFYS
WYGSARLFRFRVPPDTVLLRWLLQVSREGGTACTDAEITVHFRSGAPPVINPLGTSFPDD
TSVQPSFQVRVPLSAAPLSNASVNVSHPAPGDWFVAAHLPPSSQKIELKGLAPTCAYVFQ
PDLLVTRVVEISVMEPDVPLPHTLLSHPSYLKVFVPDYTRELLLELRDCVSSGSLGCPVR
LTVGPVTLPSNFQKVLTCTSAPWPCRLLLPSPPWDRWLQVTAESLVGPLGTVTFSAVAAL
TACRPQSVTIQPLLQSSQNQSFNASTGLPSLSPDHQDLGRSGSVDRSPFCLTNYPVMRED
MDVVSVHFQLLDRVSVRVCPNTPSMMRLRLNTGMDSGGSLTISLRANKTEMGNETVIVAC
VNAASPFLGFNSSLNCTTAFFQGYPLSLSAWSLRANLIIPYPETDNWYLSLQLMCPENAE
ECEQAVVHVETTLYLVPCLNDCGPYGQCLLLRRHSYLYAGCSCKAGWRGWSCTDNSTAQT
VAQQRAAALLLTLSNLMFLAPITVSVQRFFLVEASVYAYTMFFSTFYHACDQPGEAVLCI
LNYDTLQYCDFLGSGAAIWVTILCMARLKAVLKYVLFLLGTLVIAMSLQLDRRGIWNMLG
PCLFAFVIMASMWTYRCGHRRQCYPTSWQRWAFYLLPGISMASVGVAIYTSMMTSDNYYY
THSIWHVLLAGSAALLLPPPDEHAEPWACSQKFPCHYQICKNDREELYTVT
Download sequence
Identical sequences A0A096NKE6
ENSPANP00000013453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]