SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013460 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013460
Domain Number 1 Region: 624-675
Classification Level Classification E-value
Superfamily Eferin C-derminal domain-like 0.00000000000000129
Family Eferin C-derminal domain-like 0.0000828
Further Details:      
 
Domain Number 2 Region: 117-191
Classification Level Classification E-value
Superfamily EF-hand 0.000000000135
Family Calmodulin-like 0.055
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000013460
Domain Number - Region: 572-621
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00301
Family Mitotic arrest deficient-like 1, Mad1 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013460   Gene: ENSPANG00000000689   Transcript: ENSPANT00000017614
Sequence length 675
Comment pep:known chromosome:PapAnu2.0:20:301373:399106:1 gene:ENSPANG00000000689 transcript:ENSPANT00000017614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRRPRAPAPPPRSGPLGQLESPEAPGPGPRSEAPLPELDPLFSWTEKPEECGPPGCPESA
PFRLQGSSSSHRARGEVGLFSPFPAPTAGELALEEGPGSPPQPSDLSQTHPLPSEPAGSQ
EDGPRLRAVFDALDGDGDGFVRIEDFVQFATVYGAEQVKDLTKYLDPSGLGVISFEDFYQ
GITAIRNGDPDGQCYGGVASAQDEEPLACPDEFDDFVTYEANEVTDSAYMGSESTYSECE
TFTDEDTSTLVHPELQPEGDADSAGGSAVPSECLDAMEEPDHGALLLLPGRSHPHGQSVI
TVIGGEEHFEDYGEGSEAELSPETLCNGQLGCSDPAFLTPSPTKRLSSKKAARYLHQSGA
LTMEALEDPSPEPVEGPEEDIADKVVFLERRVLELEKDTAATGEQHSRLRQENLQLVHRA
NALEEQLKEQELRACEMVLEETRRQKELLCKMEREKSIEIENLQARLQQLDEENSELRSC
TPCLKANIERLEEEKQKLLDEIESLTLRLSEEQENKRRMGDRLSHERHQFQRDKEATQEL
IEDLRKQLEHLQLLKLEAEQRRGRSSSMGLQEYHSRARESELEQEVRRLKQDNRNLKEQN
EELNGQIITLSIQGAKSLFSTAFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRI
IVAIMETNPSILEVK
Download sequence
Identical sequences ENSPANP00000013460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]