SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013470 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013470
Domain Number 1 Region: 23-304
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.28e-71
Family FCH domain 0.003
Further Details:      
 
Domain Number 2 Region: 401-485
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-20
Family SH3-domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013470   Gene: ENSPANG00000007159   Transcript: ENSPANT00000019764
Sequence length 486
Comment pep:known_by_projection chromosome:PapAnu2.0:10:83091117:83112418:-1 gene:ENSPANG00000007159 transcript:ENSPANT00000019764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFYGYDWEVITQHRMDDIKAVGNYKRTVKRIDDGHRLCSDLMNCLHERARIEKAYAQQLT
EWARRWRQLVEKGPQYGTVEKAWMAFMSEAERVSELHLEVKASLMNDDFEKIKNWQKEAF
HKQMMGSFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAHHAACKEEKLAISREANSKADP
SLNPEQLKKLQDKIEKCKQDVLKTKDKYEKSLKELDQGTPQYMENMEQVFEQCQQFEEKR
LRFFREVLLEVQKHLDLSNVTGYKAVYHDLEQSIRAADAVEDLRWFRANHGPGMAMNWPQ
FEEWSADLNRTLSRREKKKATDGVTLTGINQTGDQSLPNKPSSTLNVPSNPAQSAQSQSS
YNPFEDEDDTGSTVSEKEDTKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFD
DDATSGTEVRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPAN
YVEAIQ
Download sequence
Identical sequences ENSPANP00000013470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]