SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013473 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013473
Domain Number 1 Region: 64-183,259-364
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.88e-64
Family FabD-like 0.0000947
Further Details:      
 
Domain Number 2 Region: 192-266
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.000000275
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013473   Gene: ENSPANG00000009929   Transcript: ENSPANT00000006857
Sequence length 390
Comment pep:known_by_projection chromosome:PapAnu2.0:10:83348768:83361161:-1 gene:ENSPANG00000009929 transcript:ENSPANT00000006857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRVARTAWARGLGASGRRGVSSFPVPPPGAQGVAELLRDATGAEEEAPSAATERRMPG
QCSVLLFPGQGSQVVGMGRGLLGYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHC
QPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAEGLYAVKIRAE
AMQEASEAVPSGMLSVLGQRQSEFNFACLEAREHCKSLGMENPVCEVSNYLFPDCRVISG
HREALQFLQKNSSKFHFRRARMLPVSGAFHTRLMEPAVEPLTQVLKAIDIKKPLVSVYSN
VHGHRYMHPSHIQKLLAQQVVSPVKWEQTMHAIYERKKGREFPQTFEVGPGRQLGAILKS
CNMQAWKSYSAVNVLQTLEPVDLDPEEPPR
Download sequence
Identical sequences A0A096NKG6
ENSPANP00000013473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]