SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013481 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013481
Domain Number 1 Region: 4-167
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.93e-30
Family G proteins 0.00089
Further Details:      
 
Domain Number 2 Region: 417-580
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.56e-19
Family G proteins 0.013
Further Details:      
 
Domain Number 3 Region: 168-268,310-349
Classification Level Classification E-value
Superfamily EF-hand 9.47e-16
Family Calmodulin-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013481   Gene: ENSPANG00000006971   Transcript: ENSPANT00000006865
Sequence length 618
Comment pep:known_by_projection chromosome:PapAnu2.0:20:548435:553651:1 gene:ENSPANG00000006971 transcript:ENSPANT00000006865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRDVRILLLGEAQVGKTSLILSLVGEEFPEEVPPRAEEITIPADVTPEKVPTHIVDYSE
AEQTDEELREEIHKANVVCVVYDVSEEATIEKIRTKWIPLVNGGTTRGPRVPIILVGNKS
DLRSGSSMEAVLPIMSQFPEIETCVECSAKNLRNISELFYYAQKAVLHPTAPLYDPEAKQ
LRPACAQALTRIFRLSDQDLDQALSDEELNAFQKSCFGHPLAPQALEDVKTVVCRNVAGG
VWEDRLTLDGFLFLNTLFIQRGRHETTWTILRSFGYSDTLELTADYLFPPLHVPPGCSTE
LNHLGYQFVQRVFEKHDQDRDGALSPMELQSLFSVFPAAPWGPELLRTVRTEAGRLPLHG
YLCQWTLVTYLDVRSCLGHLGYLGYPTLCDQDSQTRAITVTREKRLDQEKGQTLRSVLLC
KVVGARGVGKSAFLQAFLGHGLGHQDTREQPPGYTIDTVQVNGQEKYLILCEVGTDDLAT
SLDAACDVACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGGVPVGPSPA
EFCRKHRLPAPVPFSCAGPAEPSTAIFTQLATMATFPHLVHAELHPSSFWLRGLLGVLGA
AMAAVLSFSLYRVLVKSQ
Download sequence
Identical sequences A0A096NKH4
ENSPANP00000013481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]