SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013536 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013536
Domain Number 1 Region: 299-361
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000576
Family PHD domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013536   Gene: ENSPANG00000014566   Transcript: ENSPANT00000007426
Sequence length 489
Comment pep:known_by_projection chromosome:PapAnu2.0:10:85088009:85218575:-1 gene:ENSPANG00000014566 transcript:ENSPANT00000007426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELQSRPEALAVELARHQNGDLKKQLHERQPRIAALSDKQALGTITAVPVTGPQVSSLQR
LAGQGAAVLPQVRPKTLIPDSLPVAPGRDRPPKQPPTFQKATVVSVKNPSPALPTANNTV
SHVPVPGSQPQALAEPAALASPLSSAGVAYAIISTSPSNAAAMAPSTAVSVVSDSIKVQP
LLISADNKVIIIQPQVQTQPESTAESRPPTEEPSQGAQATKKKKEDRPPTQENPEKIAFM
VALGLVTTEHLEEIQSKRQERKRRSTANPAYSGLLETERKRLASNYLNNPLFLTARANED
PCWKNEITHDEHCAACKRGANLQPCGTCPGAYHLSCLDPPLKTAPKGVWVCPRCQHKALK
KDEGVPWTGMLAIVHSYVTHKTVKEEEKQKLLQRGSELQNEHQQLEERDRRLASAVQKCL
ELKTNLLARQRGTQSSLDRLRALLRLIQGEQLLQVTMATTSPAPLLAGPWTKPSVAATHP
TLQHPQGHN
Download sequence
Identical sequences A0A096NKM9
ENSPANP00000013536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]