SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013546 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013546
Domain Number 1 Region: 99-371
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.75e-80
Family Eukaryotic proteases 0.0000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013546   Gene: ENSPANG00000009724   Transcript: ENSPANT00000007425
Sequence length 374
Comment pep:novel chromosome:PapAnu2.0:20:1098306:1101270:-1 gene:ENSPANG00000009724 transcript:ENSPANT00000007425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVGTATQWLNERPLPRRPSSEERTDQAAAHFLRLRIKGLRGAGGESCRVPAGERAAECP
HGKGIIPSLMPAGGSWPPPLIPGLSPQPTPHALSPQMLLLLFLAVSSLGSCSAGSPVPVP
ENDLVGIVGGHNAPQGKWPWQVSLRIYSYQWASWVHICGGSLIHPQWVLTAAHCIFQKDT
DPSTYRIHAGDVYLYGGRGLLNVSRIIVHPNYVTAGLGADVALLQLANPVICAADVRTVK
LSPVSLELTPRDKCWVTGWGAIKMFESLPPPYRLQQVSVQVLENAICDQQYRNASGHTGD
RQLILDDMLCAGSEGRDSCYGDSGGPLVCRVRRSWRLVGVVSWGYGCALRDFPGVYARVQ
TYVPWILKQVGELP
Download sequence
Identical sequences A0A096NKN9
ENSPANP00000013546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]