SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013563 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013563
Domain Number 1 Region: 282-315
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000053
Family CCCH zinc finger 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000013563
Domain Number - Region: 657-712
Classification Level Classification E-value
Superfamily RING/U-box 0.000883
Family RING finger domain, C3HC4 0.023
Further Details:      
 
Domain Number - Region: 81-103
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0392
Family CCCH zinc finger 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013563   Gene: ENSPANG00000015754   Transcript: ENSPANT00000005532
Sequence length 717
Comment pep:known_by_projection chromosome:PapAnu2.0:20:1221818:1271008:-1 gene:ENSPANG00000015754 transcript:ENSPANT00000005532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSVSKAAAAALSGSPPQTEKPTHYRYLKEFRTEQCPLFSQHKCAQHRPFTCFHWHFLNQ
RRRRPLRRRDGTFNYSPDVYCSKYNEATGVCPDGDECPYLHRTTGDTERKYHLRYYKTGT
CIHETDARGHCVKNGLHCAFAHGPLDLRPPVCDVRELQAQEALQNGQLGSGEGVPDLQPG
VLASQAMIEKILSEDPRWQDANFVLGSYKTEQCPKPPRLCRQGYACPHYHNSRDRRRNPR
RFQYRSTPCPSVKHGDEWGEPARCDGGDGCQYCHSRTEQQFHPEIYKSTKCNDMRQTGYC
PRGPFCAFAHIEKSLGMVNDWGCRDLHLTSPASTGSGPPGNAKRRDSPAEGGPKGSEQDS
KQNHLAVFAAVHPPAPSVSSSVASSLASSAGSGSSSPTALPAPPTRALPLSPAGSTVEAV
LEKDLEEQDGHDLGPAGPRSLAGSAPVTIPGSLPRAPSLHSPSSASTSPLSSLSQPLPGP
VGSSAMTPPQQPPPLRSEPGALGSSASSFSSLGLNGVPGSIWDFVSGSFSPSPTPILSTG
PPSSSGSSPNGTELARVRRQLDEAKRKIRQWEESWQQVKQVCDAWQREAQEAKERDRVAD
SDRQLALQKKEEVEAQVKQLQEELEGLGVASTLPGLRGCGDIGTIPLPKLHSLQSQLRLD
LEAVDGVIFQLRAKQCVACRERAHGAVLRPCQHRVLCEPCAAAAPECPYCKGQPLRW
Download sequence
Identical sequences ENSPANP00000013563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]