SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013566 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013566
Domain Number 1 Region: 193-503
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.14e-117
Family Transglutaminase core 0.0000000000106
Further Details:      
 
Domain Number 2 Region: 9-192
Classification Level Classification E-value
Superfamily E set domains 2.31e-56
Family Transglutaminase N-terminal domain 0.00000000971
Further Details:      
 
Domain Number 3 Region: 519-629
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.44e-31
Family Transglutaminase, two C-terminal domains 0.00000111
Further Details:      
 
Domain Number 4 Region: 631-729
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.09e-28
Family Transglutaminase, two C-terminal domains 0.00000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013566   Gene: ENSPANG00000017903   Transcript: ENSPANT00000005886
Sequence length 733
Comment pep:known_by_projection chromosome:PapAnu2.0:4:5976593:6131831:-1 gene:ENSPANG00000017903 transcript:ENSPANT00000005886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSETSRIAFGGRRAVPPNNSNAAEDDLPTLEPQGVMPRGVNLQEFLNVTSIHLFKERWDT
NKVDHHTDKYENNKLIVRRGQSFYIQIDFNRPYDPRRDLFRVEYVIVGRYPQENKGTYIP
VPIVSELQSGKWGAKIVMREDRSVRLSIQSSPECIVGKFRMYVAVWTPYGIIRTSRNPET
DTYILFNPWCEDDAVYLDNEKEREEYVLNDIGVIFYGEVNDIKTRSWSYGQFEDGILDTC
LYVMDRAQMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNIYAYGVPPSAWTGSVDI
LLEYQSSENPVRYGQCWVFAGVFNTFLRCLGIPARIVTNYFSAHDNDANLQMDIFLEEDG
NVNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAIK
HGHVCFQFDAPFVFAEVNSDLIYITAKKDGTHVVENVDATHIGKLIVTKQIGGDGMMDIT
DTYKFQEGQEEERLALETALMYGAKKPLNTEGVMKSRSKVDMDFEVENAVLGKDLKLTIT
FRNNSHNHYTITAYLSANITFYTGVSKAEFKKETFDVTLEPLSFKKEAVVIQAGEYMGQL
LEQASLHFFVTARINETRDVLAKQKSTVLTIPKLIIKVRGAQVVGSDMIVTVEFTNPLKE
TLRNVWIHLDGPGITRPVRKMFREIRPNSTVQWEEVCRPWVSGPRKLIASMSSDSLRHVY
GELDVQIQRRPSM
Download sequence
Identical sequences ENSPANP00000013566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]