SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013591 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013591
Domain Number 1 Region: 1046-1272
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-40
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 2 Region: 76-188
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-29
Family Cadherin 0.0009
Further Details:      
 
Domain Number 3 Region: 509-614
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-28
Family Cadherin 0.00054
Further Details:      
 
Domain Number 4 Region: 400-507
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-28
Family Cadherin 0.0012
Further Details:      
 
Domain Number 5 Region: 1296-1493
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.34e-27
Family Laminin G-like module 0.015
Further Details:      
 
Domain Number 6 Region: 181-303
Classification Level Classification E-value
Superfamily Cadherin-like 8.42e-26
Family Cadherin 0.00066
Further Details:      
 
Domain Number 7 Region: 610-724
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-24
Family Cadherin 0.0015
Further Details:      
 
Domain Number 8 Region: 303-404
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-22
Family Cadherin 0.0012
Further Details:      
 
Domain Number 9 Region: 2-82
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000013
Family Cadherin 0.001
Further Details:      
 
Domain Number 10 Region: 718-820
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000671
Family Cadherin 0.01
Further Details:      
 
Domain Number 11 Region: 973-1063,1261-1309
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000518
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 12 Region: 1626-1666
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 13 Region: 1497-1530
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000141
Family EGF-type module 0.014
Further Details:      
 
Domain Number 14 Region: 1532-1578
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000745
Family EGF-type module 0.009
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000013591
Domain Number - Region: 2096-2351
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000394
Family Rhodopsin-like 0.026
Further Details:      
 
Domain Number - Region: 1676-1727
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00602
Family Hormone receptor domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013591   Gene: ENSPANG00000004310   Transcript: ENSPANT00000020122
Sequence length 2574
Comment pep:known_by_projection chromosome:PapAnu2.0:10:86558657:86739239:-1 gene:ENSPANG00000004310 transcript:ENSPANT00000020122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSDRDSPVNANLRYRVLGGAWDVFQLNESSGVVSTRALDREEAAEYQLLVEANDQGRNPG
PLSATATVYIEVEDENDNYPQFSEQNYVVQVPEDVGLNTAVLRVQATDRDQGQNAAIHYS
ILSGNVAGQFYLHSLSGILDVINPLDFEDVQKYSLSIKAQDGGRPPLINSSGVVSVQVLD
VNDNEPIFVSSPFQATVLENVPLGYPVVHIQAVDADSGENARLHYRLVDTASAFLGGGSA
GPKNPAPTPDFPFQIHNSSGWITVCAELDREEVEHYSFGVEAVDHGSPPMSSSTSVSITV
LDVNDNDPVFTQPTYELRLNEDAAVGSSVLTLQARDRDANSVITYQLTGGNTRNRFALSS
QRGGGLITLALPLDYKQEQQYVLAVTASDGTRSHTAHVLINVTDANTHRPVFQSSHYTVS
VSEDRPVGTSIATLSANDEDTGENARITYVIQDPVPQFRIDPDSGTMYTMMELDYENQVA
YTLTIMAQDNGIPQKSDTTTLEILILDANDNAPQFLWDFYQGSIFEDAPPSTSILQVSAT
DRDSGPNGRLLYTFQGGDDGDGDFYIEPTSGVIRTQRRLDRENVAVYNLWALAVDRGSPT
PLSASVEIQVTILDINDNAPMFEKDELELFVEENNPVGSVVAKIRANDPDEGPNAQIMYQ
IVEGDMRHFFQLDLLNGDLRAMVELDFEVRREYVLVVQATSAPLVSRATVHILLVDQNDN
PPVLPDFQILFNNYVTNKSNNFPTGVIGRIPAHDPDVSDSLNYTFLQGNELRLLLLDPAT
GELQLSRDLDNNRPLEALMEVSVSDGIHSVTAFCTLRVTIITDDMLTNSITVRLENMSQE
KFLSPLLALFVEGVAAVLSTTKDDVFVFNVQNDTDVSSNILNVTFSALLPGGVRGQFFPS
EDLQEQIYLNRTLLTTISTQRVLPFDDNICLREPCENYMKCVSVLRFDSSAPFLSSTTVL
FRPIHPINGLRCRCPPGFTGDYCETEIDLCYSNPCGANGRCHSREGGYTCECFQDFTGEH
CEVDARSGRCANGVCKNGGTCVNLLIGGFHCVCPPGEYERPYCEVTTRSFPPRSFVTFRG
LRQRFHFTVSLTFATQERNGLLLYNGRFNEKHDFIALEIVDEQVQLTFSAGETTTTVAPK
VPGGVSDGRWHSVQVQYYNKPNIGHLGLPHGPSGEKMAVVTVDDCDTTMAVRFGKDIGNY
SCAAQGTQTGSKKSLDLTGPLLLGGVPNLPEDFPVHNRQFVGCMRNLSVDGKNVDMAGFI
ANNGTREGCAARRNFCDGRRCQNGGTCVNRWNMYLCECPLRFGGKNCEQAMPHPQLFSGE
SVVSWSDLNVIISVPWYLGLMFRTRKEDSVLMEATSGGPTSFRLQILNNYLQFEVSHGPS
DVESVMLSRLRVTDGEWHHLLIELKNVKEDSEMKHLVTMTLDYGMDQNRADIGGMLPGLT
IRSVVVGGASEDKVSVRRGFRGCMQGVRMGGTPTNVATLNMNNALKVRVKDGCDVEDPCT
SSPCPPHSRCHDTWEDYSCICDKGYLGINCVDACHLNPCENMGACVRSPGSPQGYVCECG
PSHYGPYCENKLDLPCPRGWWGNPVCGPCHCAVSKGFDPDCNKTNGQCQCKENYYKPPAQ
DTCLPCDCFPHGSHSRTCDMATGQCACKPGVIGRQCNRCDNPFAEVTTFGCEVIYNGCPK
AFEAGIWWPQTKFGQPAAVPCPKGSVGNAVRHCSGEKGWLPPELFNCTTISFVDLRAMNE
KLSRNETQVDGAGALRLVRALRNATQHTGTLFGNDVRTAYQLLGRVLQHESWQQGFDLAA
TQDADFHEDVIHSGSALLAPATRAAWEQIQRSEGGTAQLLQRLEGYFSNVARNVRRTYLR
PFVIVTANMILAVDIFDKFNFTGARVPQFDAIREEFPRELESSISFPADFFKPPEEKEGP
LVRPAGRRTSPQSPRPEPGTEREAPISRRRRHPDDAGQFAVALVIIYRTLGQLLPERYDP
DRRSLRLPHRPIINTPMVSALVYSEGAPLPRPLERPVLVEFALLEVEERTKPVCVFWNHS
LAVSGTGGWSARGCELLSRNRTHVACQCSHTASFAVLMDVSRRENGEVLPLKIVTYAAVS
LSLAALLVAFVLLSLVRTLRSNLHSIHKHLAAALFLSQLVFVIGINQTENPFLCTVVAIL
LHYIYMSTFAWTLVESLHVYRMLTEARNIDTGPMRFYYVVGWGIPAIVTGLAVGLDPQGY
GNPDFCWLSLQDTLIWSFAGPIGAVIIINTVTSVLSAKVSCQRKHHYYGKKGIVFLLRTA
FLLLLLISATWLLGLLAVNRDALSFHYLFAIFSGLQGPFVLLFHCVLNQEVRKHLKGVLG
GRKLHLEDSTTTRATLLTRSLNCNTTFGDGPDMLRTDLGESTASLDSTVRSGCSSRFGEV
ALELPQALAPPPSMVPAAWPDQSLAESDSEDPGGQPRLKVETKVSVELHREEQGSHRGEN
PPDRESGGTARPASCQPPEQRKGILKNKVTYPPPLMLTEQTLKGRLREKLADCEQSPTSS
RTSSLGSGGPDCAITIKNPGREPGREHLNGVAMNVRTGSVQADGSDSELTREKP
Download sequence
Identical sequences ENSPANP00000013591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]