SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013603 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013603
Domain Number 1 Region: 562-670
Classification Level Classification E-value
Superfamily Bromodomain 1.28e-32
Family Bromodomain 0.00026
Further Details:      
 
Domain Number 2 Region: 929-956,983-1042
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.87e-18
Family PWWP domain 0.016
Further Details:      
 
Domain Number 3 Region: 207-279
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 9.46e-18
Family PHD domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000013603
Domain Number - Region: 320-356
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00122
Family PHD domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013603   Gene: ENSPANG00000018351   Transcript: ENSPANT00000006398
Sequence length 1058
Comment pep:known_by_projection chromosome:PapAnu2.0:10:89933504:89982160:-1 gene:ENSPANG00000018351 transcript:ENSPANT00000006398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRKGRCHRGSAARHPSSPCSVKHSPTRETLTYAQAQRMVEIEIEGRLHRISIFDPLEII
LEDDLTAQEMSECNSNKENSERPPVCLRTKRHKNNRVKKKNEALPSAHGMPASASALPEP
KVRIVEYSPPSAPRRPPVYYKFIEKSAEELDNEVEYDMDEEDYAWLEIVNEKRKGDCVPA
VSQSMFEFLMDRFEKESHCENQKQGEQQSLIDEDAVCCICMDGECQNSNVILFCDMCNLA
VHQECYGVPYIPEGQWLCRHCLQSRARPADCVLCPNKGGAFKKTDDDRWGHVVCALWIPE
VGFANTVFIEPIDGVRNIPPARWKLTCYLCKQKGVGACIQCHKANCYTAFHVTCAQKAGL
YMKMEPVKELTGGGTTFSVRKTAYCDVHTPPGCTRRPLNIYGDVEMKNGVCRKDSSVKTV
RSTSKVRKKAKKAKKALAEPCAVLPTVCAPYIPPQRLNRIANQVAIQRKKQFVERAHSYW
LLKRLSRNGAPLLRRLQSSLQSQRSSQQRENDEEMKAAKEKLKYWQRLRHDLERARLLIE
LLRKREKLKREQVKVEQVAMELRLTPLTVLLRSVLDQLQDKDPARIFAQPVSLKEVPDYL
DHIKQPMDFATMRKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAAVRLRDQGG
VVLRQARREVDSIGLEEASGMHLAERPAAAPRRPFSWEDVDRLLDPANRAHLGLEEQLRE
LLDMLDLTCAMKSSGSRSKRAKLLKKEIALLRNKLSQQHSQPPPMGPGSEGCDEDGAPLG
LEAGEEVLPRLETLLQPRKRSRSTCGDSEVEEESPGKRLDAGLTNGFGGTRSEQEPGGGL
GRKATPRRRCASESSISSSNSPLCDSSFSVPKCGRGKPALVRRHTLEDRSELISCIENGN
YAKAARIAAEVGQNSMWISTDAAASVLEPLKVVWAKCSGYPSYPALIIDPKMPRVPGHHN
GVTIPAPPLDVLKIGEHMQTKSDEKLFLVLFFDNKRSWQWLPKSKMVPLGIDETIDKLKM
MEGRNSSIRKAVRIAFDRAMNHLSRVHGEPTSDLSDID
Download sequence
Identical sequences A0A096NKU6
ENSPANP00000013603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]